PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01791.1.p
Common NameEUGRSUZ_I01791, LOC104419258
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 211aa    MW: 24296.4 Da    PI: 7.9829
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01791.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.39.7e-201461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg WT eEd++l d+v+++G g+W++Iar+ g++R++k+c++rw +yl
  Eucgr.I01791.1.p 14 RGLWTVEEDKILMDYVTEHGRGQWNSIARRTGLRRCGKSCRLRWMNYL 61
                      788*******************************************97 PP

2Myb_DNA-binding61.81.4e-1967112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       r+ +T+eE++l+v+++++lG++ W++Ia++++ gRt++q+k++w++yl
  Eucgr.I01791.1.p  67 RDHFTEEEEDLIVRLHNLLGNR-WSLIAKRVP-GRTDNQVKNYWNTYL 112
                       6789******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.354961IPR017930Myb domain
SuperFamilySSF466892.08E-3112108IPR009057Homeodomain-like
SMARTSM007171.7E-141363IPR001005SANT/Myb domain
PfamPF002495.0E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-241568IPR009057Homeodomain-like
CDDcd001671.63E-111761No hitNo description
PROSITE profilePS5129428.18462116IPR017930Myb domain
SMARTSM007172.2E-1866114IPR001005SANT/Myb domain
PfamPF002492.1E-1867112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2669116IPR009057Homeodomain-like
CDDcd001677.94E-1470112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0048629Biological Processtrichome patterning
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MTKTEGGGGS QLKRGLWTVE EDKILMDYVT EHGRGQWNSI ARRTGLRRCG KSCRLRWMNY  60
LSPDIKRDHF TEEEEDLIVR LHNLLGNRWS LIAKRVPGRT DNQVKNYWNT YLSKKLGIKK  120
QICQVGRTKS RILHISESST HKDSISSCAG NSRSSEMNVD KSPESQEMLD LPELTSREEY  180
STPSFWDFES DLEMNLSMME FLDGHSLPSY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2981161108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAPTransfer from AT5G40330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01791.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029175.11e-156PREDICTED: transcription factor MYB23-like
SwissprotQ962762e-72MYB23_ARATH; Transcription factor MYB23
TrEMBLA0A059APY41e-156A0A059APY4_EUCGR; Uncharacterized protein
STRINGAT5G40330.14e-70(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.19e-74myb domain protein 23